General Information

  • ID:  hor002370
  • Uniprot ID:  Q25413??191-197)
  • Protein name:  SMSMLRL-amide
  • Gene name:  NA
  • Organism:  Lymnaea stagnalis (Great pond snail) (Helix stagnalis)
  • Family:  Myomodulin family
  • Source:  animal
  • Expression:  Expressed in all ganglia of the CNS, but only in a subset of neurons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lymnaea (genus), Lymnaeidae (family), Lymnaeoidea (superfamily), Hygrophila, Panpulmonata, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SMSMLRL
  • Length:  7(191-197)
  • Propeptide:  MQGAFLITFIVLTMTLVSIGNTEESGGQTSSNDKTEPAQSRTKRRSREMGRVVRGLQMLRLGKRDSVSTSEDPGDIDDILSLLQAYQEQNPEFAFNEEERELSGDELEVPEHHRFRRSTENSGVAPQEVQQSQSFKDSGEHELKLEEAEPYLYFPDGDFYYGDVDELLEGDNEDGSADKRQIPMLRLGKRSMSMLRLGKREEDDADFDEEKRSLSMLRLGKREDDNFEDSFDEENDKRSLSMLRLGKRPMSMLRL
  • Signal peptide:  MQGAFLITFIVLTMTLVSIGNT
  • Modification:  T7 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Enhance the relaxation rate of electrically-induced contraction of the penis retractor muscle.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9BQ08-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-Q9BQ08-F1.pdbhor002370_AF2.pdbhor002370_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 94426 Formula: C34H64N10O10S2
Absent amino acids: ACDEFGHIKNPQTVWY Common amino acids: LMS
pI: 10.55 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 2
Hydrophobicity: 75.71 Boman Index: -718
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 111.43
Instability Index: 9885.71 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  8522970
  • Title:  Various Isoforms of Myomodulin Identified From the Male Copulatory Organ of Lymnaea Show Overlapping Yet Distinct Modulatory Effects on the Penis Muscle